PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G13500.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 368aa    MW: 39213.8 Da    PI: 6.1864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G13500.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  OMERI04G13500.5 14 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding45.12.3e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  OMERI04G13500.5  68 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.857965IPR017930Myb domain
SuperFamilySSF466899.56E-3011108IPR009057Homeodomain-like
SMARTSM007173.8E-141363IPR001005SANT/Myb domain
PfamPF002496.3E-171461IPR001005SANT/Myb domain
CDDcd001679.08E-131761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.19766116IPR017930Myb domain
PfamPF002496.7E-1368110IPR001005SANT/Myb domain
CDDcd001671.70E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRVPCCEKD NVKRGQWTPE EDNKLLSYIT QYGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF TDAEEQTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKSFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRPS DFPSPALHDG  180
AGAGASASAL AAPCFPAAPP HHPQADDTIE RIKLGLSRAI MSDPSTASAA AAATAAPAED  240
KPWPPGDMSE GLAGIYATYN PAAHAQAQAE FRYDGAAAPG YVLGGDGDQG TSMWSHQSLY  300
SGSSGTEEAR RALPEKGNDS VGSSGGDDDA ADDGKDSGGK GAASDMSGLF ASDCVLWDLP  360
DELTNHMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635420.10.0PREDICTED: transcription factor MYB30
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0E0DF760.0A0A0E0DF76_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014912-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-112myb domain protein 103